PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01815.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 933aa    MW: 103584 Da    PI: 8.675
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01815.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.33.9e-0659115157
                              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                              +r+R  ++++ ++ ++++F+ +  +s++e +e+++  g++ +qV+ +F  +++k kk
  Rsa1.0_01815.1_g00004.1  59 KRPRDLLNPKAVKYMQTVFAIKDSISKKESREISALFGISVAQVRDFFATQKIKVKK 115
                              799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.15156116IPR001356Homeobox domain
SMARTSM003892.2E-458120IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-459122IPR009057Homeodomain-like
CDDcd000869.12E-459116No hitNo description
SuperFamilySSF466892.65E-559124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MDDAFKEEIE IGSSVESLME LLNSQKMLFH SQIDQLQDAV VTQCKLTGAA GALSIKIGKR  60
PRDLLNPKAV KYMQTVFAIK DSISKKESRE ISALFGISVA QVRDFFATQK IKVKKQVRLS  120
REKLMMSTTH AIQGDGVMEQ NNAVPHAEPL PLNSIDPEAS SISCGEGETA ALMPKEDVQE  180
EGIPPDISDS DKYFVDNIFS MLRREETFLG QMKLMEWIMQ IQDSSVLIWF LSKGGVLILT  240
TWLSQAATEE QTSVLLLILK VLCHLPLHKA SPENMSAILQ SVNGLRFYRT SGVIPENVLC  300
CVSFINVKVR IVISLVSLSD LMIRHIKQGK SIAEIMGDKT NPEDILSISN GRSENGRRLK  360
SSQGPKLLLT SADDSTRKHM LGSTPSYNKE RRKVQMVEQP GQKAAGRGPQ TVRIGTSGRS  420
RPMSADDIQK AKMRALYMNS KNIKKDTLPS AIGDTRTVVP EKPLAIQSVK DSPPSQSNEA  480
KTENTPELSA VQFPPSQNNE AKTEDKPEPS AVQQPVTVNV LVQPVNSPAV NVPVQADEFR  540
NRKLSTPPKS ISSKVGVLSR MSPQTILKNC KREQIEWHVP PGMVLDELWR VAAGANSKEA  600
DVQKNRNRRE KETTYQSLQT IPLNPKEPWD REMDFDDSLT PEIPSQQPQE ESITEPQDSL  660
DERRTAAGAA STSSSQSSSV EPDYELLAAL LKNPDLLHAL TSGQPGNLAG QDMVKLLDVI  720
KTGAPNLSSS SNMKVEEQVE VSLPSPTPST NPGMSGWGQE VTRNPFSRQT QVGASVARMS  780
TRLRVASMQW QPSNGQSIPQ HTPSAYNSFT LPHTERQHQQ RMQPRLHQNQ HLQQQPISTT  840
SYVVRESVGK MDIGTSASWR SQQSQNSYYS HQANGIGSDA SYQGNEQYMT SSNPGYESWS  900
PDNSPSRNHP NMRGQQQPSR KHDPYWNQNK RWR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621060.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
RefseqXP_013722738.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0D3ASF50.0A0A0D3ASF5_BRAOL; Uncharacterized protein
STRINGBra018540.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein